SCOP 1.73: Domain d1q9oc2: 1q9o C:108-213

Lineage for d1q9oc2 (1q9o C:108-213)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)

8. Domain d1q9oc2: 1q9o C:108-213 [96297]
   Other proteins in same PDB: d1q9oa1, d1q9ob1, d1q9ob2, d1q9oc1, d1q9od1, d1q9od2
   part of Fab s45-18
   complexed with mg

Details for d1q9oc2

PDB Entry: 1q9o, 1.79 Å

PDB Description: S45-18 Fab Unliganded

PDB Compounds: (C:) S45-2 Fab (IgG1k) light chain

SCOP Domain Sequences for d1q9oc2:

Sequence; same for both SEQRES and ATOM records:

>d1q9oc2 b.1.1.2 (C:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1q9oc2:

• d1q9oc2 first appeared in SCOP 1.67
  
• d1q9oc2 appears in SCOP 1.71
  
• d1q9oc2 appears in SCOP 1.75
  
• d1q9oc2 appears in the current release, SCOPe 2.08