Lineage for d1q9oa2 (1q9o A:108-213)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365639Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 365760Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)
  8. 365792Domain d1q9oa2: 1q9o A:108-213 [96293]
    Other proteins in same PDB: d1q9oa1, d1q9ob1, d1q9ob2, d1q9oc1, d1q9od1, d1q9od2

Details for d1q9oa2

PDB Entry: 1q9o (more details), 1.79 Å

PDB Description: S45-18 Fab Unliganded

SCOP Domain Sequences for d1q9oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q9oa2 b.1.1.2 (A:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1q9oa2:

Click to download the PDB-style file with coordinates for d1q9oa2.
(The format of our PDB-style files is described here.)

Timeline for d1q9oa2: