SCOP 1.73: Domain d1q9lb2: 1q9l B:112-211

Lineage for d1q9lb2 (1q9l B:112-211)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d1q9lb2: 1q9l B:112-211 [96283]
   Other proteins in same PDB: d1q9la1, d1q9la2, d1q9lb1, d1q9lc1, d1q9lc2, d1q9ld1

Details for d1q9lb2

PDB Entry: 1q9l, 2.28 Å

PDB Description: S25-2 Fab Unliganded 2

PDB Compounds: (B:) S25-2 Fab (IgG1k) heavy chain

SCOP Domain Sequences for d1q9lb2:

Sequence; same for both SEQRES and ATOM records:

>d1q9lb2 b.1.1.2 (B:112-211) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Timeline for d1q9lb2:

• d1q9lb2 first appeared in SCOP 1.67
  
• d1q9lb2 appears in SCOP 1.71
  
• d1q9lb2 appears in SCOP 1.75
  
• d1q9lb2 appears in the current release, SCOPe 2.08