| Class b: All beta proteins [48724] (165 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries) |
| Domain d1q9kb2: 1q9k B:112-211 [96279] Other proteins in same PDB: d1q9ka1, d1q9ka2, d1q9kb1 part of Fab s25-2 complexed with mg |
PDB Entry: 1q9k (more details), 1.96 Å
SCOP Domain Sequences for d1q9kb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q9kb2 b.1.1.2 (B:112-211) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
Timeline for d1q9kb2: