SCOP 1.71: Domain d1q99b_: 1q99 B:

Lineage for d1q99b_ (1q99 B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Sky1p [56148] (1 species)
   CMGC group; Clk subfamily; serine/threonine kinase

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56149] (5 PDB entries)

8. Domain d1q99b_: 1q99 B: [96256]
   complexed with anp, edo, moh, ni, so4

Details for d1q99b_

PDB Entry: 1q99, 2.11 Å

PDB Description: crystal structure of the saccharomyces cerevisiae sr protein kinsae, sky1p, complexed with the non-hydrolyzable atp analogue, amp-pnp

SCOP Domain Sequences for d1q99b_:

Sequence; same for both SEQRES and ATOM records:

>d1q99b_ d.144.1.7 (B:) Sky1p {Baker's yeast (Saccharomyces cerevisiae)}
ggyhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyteaaed
eikllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllalikkye
hrgipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikiadlgn
acwydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfepdeghsyt
kdddhiaqiiellgelpsyllrngkytrtffnsrgllrnisklkfwpledvltekykfsk
deakeisdflspmlqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdipgwf
eevr

Timeline for d1q99b_:

• d1q99b_ first appeared in SCOP 1.67
  
• d1q99b_ appears in SCOP 1.69
  
• d1q99b_ appears in SCOP 1.73
  
• d1q99b_ appears in the current release, SCOPe 2.08