Lineage for d1q99a_ (1q99 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220070Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1221368Protein Sky1p [56148] (1 species)
    CMGC group; Clk subfamily; serine/threonine kinase
  7. 1221369Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56149] (5 PDB entries)
  8. 1221373Domain d1q99a_: 1q99 A: [96255]
    complexed with anp, edo, moh, ni, so4

Details for d1q99a_

PDB Entry: 1q99 (more details), 2.11 Å

PDB Description: crystal structure of the saccharomyces cerevisiae sr protein kinsae, sky1p, complexed with the non-hydrolyzable atp analogue, amp-pnp
PDB Compounds: (A:) SR protein kinsae

SCOPe Domain Sequences for d1q99a_:

Sequence, based on SEQRES records: (download)

>d1q99a_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gyhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyteaaede
ikllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllalikkyeh
rgipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikiadlgna
cwydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfepdeghsytk
dddhiaqiiellgelpsyllrngkytrtffnsrgllrnisklkfwpledvltekykfskd
eakeisdflspmlqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdipgwfe
evr

Sequence, based on observed residues (ATOM records): (download)

>d1q99a_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gyhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyteaaede
ikllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllalikkyeh
rgipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikiadlgna
cwydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfetkdddhiaq
iiellgelpsyllrngkytrtffnsllrnisklkfwpledvltekykfskdeakeisdfl
spmlqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdipgwfeevr

SCOPe Domain Coordinates for d1q99a_:

Click to download the PDB-style file with coordinates for d1q99a_.
(The format of our PDB-style files is described here.)

Timeline for d1q99a_: