Lineage for d1q97a_ (1q97 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1435454Protein Sky1p [56148] (1 species)
    CMGC group; Clk subfamily; serine/threonine kinase
  7. 1435455Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56149] (5 PDB entries)
  8. 1435461Domain d1q97a_: 1q97 A: [96251]
    complexed with adn, atp, mg, ni, so4

Details for d1q97a_

PDB Entry: 1q97 (more details), 2.3 Å

PDB Description: the structure of the saccharomyces cerevisiae sr protein kinase, sky1p, with bound atp
PDB Compounds: (A:) SR protein kinase

SCOPe Domain Sequences for d1q97a_:

Sequence, based on SEQRES records: (download)

>d1q97a_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
yhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyteaaedei
kllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllalikkyehr
gipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikiadlgnac
wydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfepdeghsytkd
ddhiaqiiellgelpsyllrngkytrtffnsrgllrnisklkfwpledvltekykfskde
akeisdflspmlqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdipgwfee
vr

Sequence, based on observed residues (ATOM records): (download)

>d1q97a_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
yhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyteaaedei
kllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllalikkyehr
gipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikiadlgnac
wydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfkdddhiaqiie
llgelpsyllrngkytrtffnsllrnisklkfwpledvltekykfskdeakeisdflspm
lqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdipgwfeevr

SCOPe Domain Coordinates for d1q97a_:

Click to download the PDB-style file with coordinates for d1q97a_.
(The format of our PDB-style files is described here.)

Timeline for d1q97a_: