Lineage for d1q90r_ (1q90 R:)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 519895Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 520129Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family) (S)
  5. 520130Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)
  6. 520158Protein ISP subunit from the cytochrome b6f complex, transmembrane anchor [103428] (2 species)
  7. 520159Species Chlamydomonas reinhardtii [TaxId:3055] [103430] (1 PDB entry)
  8. 520160Domain d1q90r_: 1q90 R: [96248]
    Other proteins in same PDB: d1q90a1, d1q90a2, d1q90a3, d1q90b_, d1q90c_, d1q90d_, d1q90g_, d1q90l_, d1q90m_, d1q90n_

Details for d1q90r_

PDB Entry: 1q90 (more details), 3.1 Å

PDB Description: structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from chlamydomonas reinhardtii

SCOP Domain Sequences for d1q90r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q90r_ f.23.12.1 (R:) ISP subunit from the cytochrome b6f complex, transmembrane anchor {Chlamydomonas reinhardtii}
ssevpdmnkrnimnlilaggaglpittlalgygaffvpp

SCOP Domain Coordinates for d1q90r_:

Click to download the PDB-style file with coordinates for d1q90r_.
(The format of our PDB-style files is described here.)

Timeline for d1q90r_: