Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.24: PetL subunit of the cytochrome b6f complex [103436] (1 family) |
Family f.23.24.1: PetL subunit of the cytochrome b6f complex [103437] (1 protein) |
Protein PetL subunit of the cytochrome b6f complex [103438] (2 species) |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [103440] (1 PDB entry) |
Domain d1q90l_: 1q90 L: [96245] Other proteins in same PDB: d1q90a1, d1q90a2, d1q90a3, d1q90a4, d1q90b_, d1q90c_, d1q90d_, d1q90g_, d1q90m_, d1q90n_, d1q90r_ complexed with bcr, cla, fes, hem, lfa, lmg, sqd, tds |
PDB Entry: 1q90 (more details), 3.1 Å
SCOPe Domain Sequences for d1q90l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q90l_ f.23.24.1 (L:) PetL subunit of the cytochrome b6f complex {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} mltitsyvglligalvftlgiylgllkvvkli
Timeline for d1q90l_: