Lineage for d1q90l_ (1q90 L:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254665Superfamily f.23.24: PetL subunit of the cytochrome b6f complex [103436] (1 family) (S)
  5. 2254666Family f.23.24.1: PetL subunit of the cytochrome b6f complex [103437] (1 protein)
  6. 2254667Protein PetL subunit of the cytochrome b6f complex [103438] (2 species)
  7. 2254668Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [103440] (1 PDB entry)
  8. 2254669Domain d1q90l_: 1q90 L: [96245]
    Other proteins in same PDB: d1q90a1, d1q90a2, d1q90a3, d1q90a4, d1q90b_, d1q90c_, d1q90d_, d1q90g_, d1q90m_, d1q90n_, d1q90r_
    complexed with bcr, cla, fes, hem, lfa, lmg, sqd, tds

Details for d1q90l_

PDB Entry: 1q90 (more details), 3.1 Å

PDB Description: structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from chlamydomonas reinhardtii
PDB Compounds: (L:) Cytochrome b6f complex subunit petL

SCOPe Domain Sequences for d1q90l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q90l_ f.23.24.1 (L:) PetL subunit of the cytochrome b6f complex {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mltitsyvglligalvftlgiylgllkvvkli

SCOPe Domain Coordinates for d1q90l_:

Click to download the PDB-style file with coordinates for d1q90l_.
(The format of our PDB-style files is described here.)

Timeline for d1q90l_: