Lineage for d1q90l_ (1q90 L:)

  1. Root: SCOP 1.71
  2. 619386Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)
  3. 620228Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 620614Superfamily f.23.24: PetL subunit of the cytochrome b6f complex [103436] (1 family) (S)
  5. 620615Family f.23.24.1: PetL subunit of the cytochrome b6f complex [103437] (1 protein)
  6. 620616Protein PetL subunit of the cytochrome b6f complex [103438] (2 species)
  7. 620617Species Chlamydomonas reinhardtii [TaxId:3055] [103440] (1 PDB entry)
  8. 620618Domain d1q90l_: 1q90 L: [96245]
    Other proteins in same PDB: d1q90a1, d1q90a2, d1q90a3, d1q90b_, d1q90c_, d1q90d_, d1q90g_, d1q90m_, d1q90n_, d1q90r_
    complexed with bcr, cl1, fes, hem, lfa, lmg, sqd, tds; mutant

Details for d1q90l_

PDB Entry: 1q90 (more details), 3.1 Å

PDB Description: structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from chlamydomonas reinhardtii

SCOP Domain Sequences for d1q90l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q90l_ f.23.24.1 (L:) PetL subunit of the cytochrome b6f complex {Chlamydomonas reinhardtii}
mltitsyvglligalvftlgiylgllkvvkli

SCOP Domain Coordinates for d1q90l_:

Click to download the PDB-style file with coordinates for d1q90l_.
(The format of our PDB-style files is described here.)

Timeline for d1q90l_: