SCOP 1.69: Domain d1q90g_: 1q90 G:

Lineage for d1q90g_ (1q90 G:)

1. Root: SCOP 1.69

2. Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.26: PetG subunit of the cytochrome b6f complex [103446] (1 family)

5. Family f.23.26.1: PetG subunit of the cytochrome b6f complex [103447] (1 protein)

6. Protein PetG subunit of the cytochrome b6f complex [103448] (2 species)

7. Species Chlamydomonas reinhardtii [TaxId:3055] [103450] (1 PDB entry)

8. Domain d1q90g_: 1q90 G: [96244]
   Other proteins in same PDB: d1q90a1, d1q90a2, d1q90a3, d1q90b_, d1q90c_, d1q90d_, d1q90l_, d1q90m_, d1q90n_, d1q90r_

Details for d1q90g_

PDB Entry: 1q90, 3.1 Å

PDB Description: structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from chlamydomonas reinhardtii

SCOP Domain Sequences for d1q90g_:

Sequence; same for both SEQRES and ATOM records:

>d1q90g_ f.23.26.1 (G:) PetG subunit of the cytochrome b6f complex {Chlamydomonas reinhardtii}
mvepllcgivlglvpvtiaglfvtaylqyl

Timeline for d1q90g_:

• d1q90g_ first appeared in SCOP 1.67
  
• d1q90g_ appears in SCOP 1.71
  
• d1q90g_ appears in the current release, SCOPe 2.08