Class f: Membrane and cell surface proteins and peptides [56835] (47 folds) |
Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily) core: three transmembrane helices, up-and-down bundle |
Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family) |
Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins) a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
Protein Subunit IV of the cytochrome b6f complex [103495] (2 species) |
Species Chlamydomonas reinhardtii [TaxId:3055] [103497] (1 PDB entry) |
Domain d1q90d_: 1q90 D: [96243] Other proteins in same PDB: d1q90a1, d1q90a2, d1q90a3, d1q90b_, d1q90c_, d1q90g_, d1q90l_, d1q90m_, d1q90n_, d1q90r_ |
PDB Entry: 1q90 (more details), 3.1 Å
SCOP Domain Sequences for d1q90d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q90d_ f.32.1.1 (D:) Subunit IV of the cytochrome b6f complex {Chlamydomonas reinhardtii} tkkpdlsdpvlkaklakgmghntygepawpndllymfpvvilgtfacviglsvldpaamg epanpfatpleilpewyfypvfqilrvvpnkllgvllmaavpaglitvpfiesinkfqnp yrrpiatilfllgtlvavwlgigstfpidisltlgl
Timeline for d1q90d_: