Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (2 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
Protein Cytochrome b6 subunit of the cytochrome b6f complex [103498] (2 species) |
Species Chlamydomonas reinhardtii [TaxId:3055] [103500] (1 PDB entry) |
Domain d1q90b_: 1q90 B: [96241] Other proteins in same PDB: d1q90a1, d1q90a2, d1q90a3, d1q90c_, d1q90d_, d1q90g_, d1q90l_, d1q90m_, d1q90n_, d1q90r_ complexed with bcr, cl1, fes, hem, lfa, lmg, sqd, tds; mutant |
PDB Entry: 1q90 (more details), 3.1 Å
SCOP Domain Sequences for d1q90b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q90b_ f.21.1.2 (B:) Cytochrome b6 subunit of the cytochrome b6f complex {Chlamydomonas reinhardtii [TaxId: 3055]} vydwfeerleiqaiadditskyvpphvnifyciggitftcflvqvatgfamtfyyrptva eafasvqyimtdvnfgwlirsihrwsasmmvlmmvlhvfrvyltggfkrpreltwvtgvi mavctvsfgvtgyslpwdqvgywavkivtgvpdaipgvggfivellrggvgvgqatltrf yslhtfvlplltavfmlmhflmirkqgisgpl
Timeline for d1q90b_: