Lineage for d1q90a3 (1q90 A:248-292)

  1. Root: SCOP 1.71
  2. 619386Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)
  3. 620228Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 620606Superfamily f.23.23: Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103431] (1 family) (S)
  5. 620607Family f.23.23.1: Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103432] (1 protein)
  6. 620608Protein Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103433] (2 species)
  7. 620609Species Chlamydomonas reinhardtii [TaxId:3055] [103435] (1 PDB entry)
  8. 620610Domain d1q90a3: 1q90 A:248-292 [96240]
    Other proteins in same PDB: d1q90a1, d1q90a2, d1q90b_, d1q90c_, d1q90d_, d1q90g_, d1q90l_, d1q90m_, d1q90n_, d1q90r_
    complexed with bcr, cl1, fes, hem, lfa, lmg, sqd, tds; mutant

Details for d1q90a3

PDB Entry: 1q90 (more details), 3.1 Å

PDB Description: structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from chlamydomonas reinhardtii

SCOP Domain Sequences for d1q90a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q90a3 f.23.23.1 (A:248-292) Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor {Chlamydomonas reinhardtii}
npariqgllvffsfvlltqvllvlkkkqfekvqlaemnfhhhhhh

SCOP Domain Coordinates for d1q90a3:

Click to download the PDB-style file with coordinates for d1q90a3.
(The format of our PDB-style files is described here.)

Timeline for d1q90a3: