SCOP 1.69: Domain d1q90a2: 1q90 A:169-232

Lineage for d1q90a2 (1q90 A:169-232)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families)

5. Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein)

6. Protein Cytochrome f, small domain [51257] (4 species)

7. Species Chlamydomonas reinhardtii [TaxId:3055] [51259] (6 PDB entries)

8. Domain d1q90a2: 1q90 A:169-232 [96239]
   Other proteins in same PDB: d1q90a1, d1q90a3, d1q90b_, d1q90c_, d1q90d_, d1q90g_, d1q90l_, d1q90m_, d1q90n_, d1q90r_

Details for d1q90a2

PDB Entry: 1q90, 3.1 Å

PDB Description: structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from chlamydomonas reinhardtii

SCOP Domain Sequences for d1q90a2:

Sequence; same for both SEQRES and ATOM records:

>d1q90a2 b.84.2.2 (A:169-232) Cytochrome f, small domain {Chlamydomonas reinhardtii}
tiynasaagkivaitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpl
tnnp

Timeline for d1q90a2:

• d1q90a2 first appeared in SCOP 1.67
  
• d1q90a2 appears in SCOP 1.71
  
• d1q90a2 appears in the current release, SCOPe 2.08