Lineage for d1q90a2 (1q90 A:169-232)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 381760Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 381808Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 381846Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein)
  6. 381847Protein Cytochrome f, small domain [51257] (4 species)
  7. 381848Species Chlamydomonas reinhardtii [TaxId:3055] [51259] (6 PDB entries)
  8. 381863Domain d1q90a2: 1q90 A:169-232 [96239]
    Other proteins in same PDB: d1q90a1, d1q90a3, d1q90b_, d1q90c_, d1q90d_, d1q90g_, d1q90l_, d1q90m_, d1q90n_, d1q90r_
    complexed with bcr, cl1, fes, hem, lfa, lmg, sqd, tds; mutant

Details for d1q90a2

PDB Entry: 1q90 (more details), 3.1 Å

PDB Description: Structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from Chlamydomonas reinhardtii

SCOP Domain Sequences for d1q90a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q90a2 b.84.2.2 (A:169-232) Cytochrome f, small domain {Chlamydomonas reinhardtii}
tiynasaagkivaitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpl
tnnp

SCOP Domain Coordinates for d1q90a2:

Click to download the PDB-style file with coordinates for d1q90a2.
(The format of our PDB-style files is described here.)

Timeline for d1q90a2: