SCOPe 2.03: Domain d1q8vb_: 1q8v B:

Lineage for d1q8vb_ (1q8v B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [82032] (9 PDB entries)

8. Domain d1q8vb_: 1q8v B: [96232]
   complexed with ca, man, mn

Details for d1q8vb_

PDB Entry: 1q8v, 1.85 Å

PDB Description: pterocarpus angolensis lectin (pal) in complex with the trimannoside [man(alpha1-3)]man(alpha1-6)man

PDB Compounds: (B:) lectin

SCOPe Domain Sequences for d1q8vb_:

Sequence; same for both SEQRES and ATOM records:

>d1q8vb_ b.29.1.1 (B:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
a

Timeline for d1q8vb_:

• d1q8vb_ first appeared in SCOP 1.67
  
• d1q8vb_ appears in SCOPe 2.02
  
• d1q8vb_ appears in SCOPe 2.04
  
• d1q8vb_ appears in the current release, SCOPe 2.08