SCOPe 2.01: Domain d1q8md_: 1q8m D:

Lineage for d1q8md_ (1q8m D:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein TREM-1 (triggering receptor expressed on myeloid cells 1) [101506] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101507] (2 PDB entries)
   Uniprot Q9NP99 21-133

8. Domain d1q8md_: 1q8m D: [96218]
   complexed with gsh, so4

Details for d1q8md_

PDB Entry: 1q8m, 2.6 Å

PDB Description: crystal structure of the human myeloid cell activating receptor trem-1

PDB Compounds: (D:) triggering receptor expressed on myeloid cells 1

SCOPe Domain Sequences for d1q8md_:

Sequence; same for both SEQRES and ATOM records:

>d1q8md_ b.1.1.1 (D:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]}
melraatklteekyelkegqtldvkcdytlekfassqkawqiirdgempktlacterpsk
nshpvqvgriiledyhdhgllrvrmvnlqvedsglyqcviyqppkephmlfdrirlvvtl
e

Timeline for d1q8md_:

• d1q8md_ first appeared in SCOP 1.67
  
• d1q8md_ appears in SCOP 1.75
  
• d1q8md_ appears in SCOPe 2.02
  
• d1q8md_ appears in the current release, SCOPe 2.08, called d1q8md1