SCOP 1.67: Domain d1q8mc_: 1q8m C:

Lineage for d1q8mc_ (1q8m C:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein TREM-1 (triggering receptor expressed on myeloid cells 1) [101506] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101507] (1 PDB entry)

8. Domain d1q8mc_: 1q8m C: [96217]

Details for d1q8mc_

PDB Entry: 1q8m, 2.6 Å

PDB Description: crystal structure of the human myeloid cell activating receptor trem-1

SCOP Domain Sequences for d1q8mc_:

Sequence; same for both SEQRES and ATOM records:

>d1q8mc_ b.1.1.1 (C:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens)}
melraatklteekyelkegqtldvkcdytlekfassqkawqiirdgempktlacterpsk
nshpvqvgriiledyhdhgllrvrmvnlqvedsglyqcviyqppkephmlfdrirlvvtl
e

Timeline for d1q8mc_:

• d1q8mc_ is new in SCOP 1.67
  
• d1q8mc_ appears in SCOP 1.69
  
• d1q8mc_ appears in the current release, SCOPe 2.08, called d1q8mc1