Lineage for d1q8ma_ (1q8m A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1105630Protein TREM-1 (triggering receptor expressed on myeloid cells 1) [101506] (2 species)
  7. 1105631Species Human (Homo sapiens) [TaxId:9606] [101507] (2 PDB entries)
    Uniprot Q9NP99 21-133
  8. 1105634Domain d1q8ma_: 1q8m A: [96215]
    complexed with gsh, so4

Details for d1q8ma_

PDB Entry: 1q8m (more details), 2.6 Å

PDB Description: crystal structure of the human myeloid cell activating receptor trem-1
PDB Compounds: (A:) triggering receptor expressed on myeloid cells 1

SCOPe Domain Sequences for d1q8ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q8ma_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]}
melraatklteekyelkegqtldvkcdytlekfassqkawqiirdgempktlacterpsk
nshpvqvgriiledyhdhgllrvrmvnlqvedsglyqcviyqppkephmlfdrirlvvtl
e

SCOPe Domain Coordinates for d1q8ma_:

Click to download the PDB-style file with coordinates for d1q8ma_.
(The format of our PDB-style files is described here.)

Timeline for d1q8ma_: