Lineage for d1q86w_ (1q86 W:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 904111Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 904128Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
  5. 904129Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 904130Protein Ribosomal protein L29 (L29p) [46563] (5 species)
  7. 904171Species Haloarcula marismortui [TaxId:2238] [46564] (44 PDB entries)
    Uniprot P10971
  8. 904209Domain d1q86w_: 1q86 W: [96188]
    Other proteins in same PDB: d1q861_, d1q862_, d1q863_, d1q864_, d1q86c1, d1q86c2, d1q86d_, d1q86e_, d1q86f_, d1q86g1, d1q86g2, d1q86h_, d1q86i_, d1q86j_, d1q86k_, d1q86l_, d1q86m_, d1q86n_, d1q86o_, d1q86p_, d1q86q_, d1q86r_, d1q86s_, d1q86t_, d1q86u_, d1q86v_, d1q86x_, d1q86y_, d1q86z_
    protein/RNA complex; complexed with cd, cl, k, mg, na, pha

Details for d1q86w_

PDB Entry: 1q86 (more details), 3 Å

PDB Description: crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
PDB Compounds: (W:) 50S ribosomal protein L29P

SCOPe Domain Sequences for d1q86w_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q86w_ a.2.2.1 (W:) Ribosomal protein L29 (L29p) {Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

SCOPe Domain Coordinates for d1q86w_:

Click to download the PDB-style file with coordinates for d1q86w_.
(The format of our PDB-style files is described here.)

Timeline for d1q86w_: