Lineage for d1q86v_ (1q86 V:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750235Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 750236Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families) (S)
  5. 750455Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)
  6. 750456Protein Ribosomal protein L24e [57750] (1 species)
  7. 750457Species Archaeon Haloarcula marismortui [TaxId:2238] [57751] (44 PDB entries)
  8. 750496Domain d1q86v_: 1q86 V: [96187]
    Other proteins in same PDB: d1q861_, d1q862_, d1q863_, d1q864_, d1q86c1, d1q86c2, d1q86d_, d1q86e_, d1q86f_, d1q86g1, d1q86g2, d1q86h_, d1q86i_, d1q86j_, d1q86k_, d1q86l_, d1q86m_, d1q86n_, d1q86o_, d1q86p_, d1q86q_, d1q86r_, d1q86s_, d1q86t_, d1q86u_, d1q86w_, d1q86x_, d1q86y_, d1q86z_
    complexed with cd, cl, k, mg, na, pha

Details for d1q86v_

PDB Entry: 1q86 (more details), 3 Å

PDB Description: crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
PDB Compounds: (V:) 50S ribosomal protein L24e

SCOP Domain Sequences for d1q86v_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q86v_ g.39.1.6 (V:) Ribosomal protein L24e {Archaeon Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

SCOP Domain Coordinates for d1q86v_:

Click to download the PDB-style file with coordinates for d1q86v_.
(The format of our PDB-style files is described here.)

Timeline for d1q86v_: