SCOP 1.69: Domain d1q86v_: 1q86 V:

Lineage for d1q86v_ (1q86 V:)

1. Root: SCOP 1.69

2. Class g: Small proteins [56992] (75 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (13 families)

5. Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)

6. Protein Ribosomal protein L24e [57750] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [57751] (19 PDB entries)

8. Domain d1q86v_: 1q86 V: [96187]
   Other proteins in same PDB: d1q861_, d1q862_, d1q863_, d1q864_, d1q86c1, d1q86c2, d1q86d_, d1q86e_, d1q86f_, d1q86g1, d1q86g2, d1q86h_, d1q86i_, d1q86j_, d1q86k_, d1q86l_, d1q86m_, d1q86n_, d1q86o_, d1q86p_, d1q86q_, d1q86r_, d1q86s_, d1q86t_, d1q86u_, d1q86w_, d1q86x_, d1q86y_, d1q86z_

Details for d1q86v_

PDB Entry: 1q86, 3 Å

PDB Description: crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.

SCOP Domain Sequences for d1q86v_:

Sequence; same for both SEQRES and ATOM records:

>d1q86v_ g.39.1.6 (V:) Ribosomal protein L24e {Archaeon Haloarcula marismortui}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

Timeline for d1q86v_:

• d1q86v_ first appeared in SCOP 1.67
  
• d1q86v_ appears in SCOP 1.71
  
• d1q86v_ appears in the current release, SCOPe 2.08