Lineage for d1q86f_ (1q86 F:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727201Fold d.77: Ribosomal protein L5 [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 727202Superfamily d.77.1: Ribosomal protein L5 [55282] (1 family) (S)
  5. 727203Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)
  6. 727204Protein Ribosomal protein L5 [55284] (3 species)
    synonym: 50S ribosomal protein L5p, HMAL5, HL13
  7. 727205Species Archaeon Haloarcula marismortui [TaxId:2238] [55285] (40 PDB entries)
  8. 727244Domain d1q86f_: 1q86 F: [96170]
    Other proteins in same PDB: d1q861_, d1q862_, d1q863_, d1q864_, d1q86c1, d1q86c2, d1q86d_, d1q86e_, d1q86g1, d1q86g2, d1q86h_, d1q86i_, d1q86j_, d1q86k_, d1q86l_, d1q86m_, d1q86n_, d1q86o_, d1q86p_, d1q86q_, d1q86r_, d1q86s_, d1q86t_, d1q86u_, d1q86v_, d1q86w_, d1q86x_, d1q86y_, d1q86z_
    complexed with cd, cl, k, mg, na, pha

Details for d1q86f_

PDB Entry: 1q86 (more details), 3 Å

PDB Description: crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
PDB Compounds: (F:) 50S ribosomal protein L5P

SCOP Domain Sequences for d1q86f_:

Sequence, based on SEQRES records: (download)

>d1q86f_ d.77.1.1 (F:) Ribosomal protein L5 {Archaeon Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev

Sequence, based on observed residues (ATOM records): (download)

>d1q86f_ d.77.1.1 (F:) Ribosomal protein L5 {Archaeon Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
hrlnpadavafiestydvev

SCOP Domain Coordinates for d1q86f_:

Click to download the PDB-style file with coordinates for d1q86f_.
(The format of our PDB-style files is described here.)

Timeline for d1q86f_: