Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.22: Ribosomal protein L4 [52165] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) |
Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein) |
Protein Ribosomal protein L4 [52168] (5 species) synonym: 50S ribosomal protein L4e, HMAL4, HL6 |
Species Haloarcula marismortui [TaxId:2238] [52170] (46 PDB entries) Uniprot P12735 |
Domain d1q86e_: 1q86 E: [96169] Other proteins in same PDB: d1q861_, d1q862_, d1q863_, d1q864_, d1q86c1, d1q86c2, d1q86d_, d1q86f_, d1q86g1, d1q86g2, d1q86h_, d1q86i_, d1q86j_, d1q86k_, d1q86l_, d1q86m_, d1q86n_, d1q86o_, d1q86p_, d1q86q_, d1q86r_, d1q86s_, d1q86t_, d1q86u_, d1q86v_, d1q86w_, d1q86x_, d1q86y_, d1q86z_ protein/RNA complex; complexed with cd, cl, k, mg, na, pha |
PDB Entry: 1q86 (more details), 3 Å
SCOPe Domain Sequences for d1q86e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q86e_ c.22.1.1 (E:) Ribosomal protein L4 {Haloarcula marismortui [TaxId: 2238]} mqatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal aevaer
Timeline for d1q86e_:
View in 3D Domains from other chains: (mouse over for more information) d1q861_, d1q862_, d1q863_, d1q864_, d1q86c1, d1q86c2, d1q86d_, d1q86f_, d1q86g1, d1q86g2, d1q86h_, d1q86i_, d1q86j_, d1q86k_, d1q86l_, d1q86m_, d1q86n_, d1q86o_, d1q86p_, d1q86q_, d1q86r_, d1q86s_, d1q86t_, d1q86u_, d1q86v_, d1q86w_, d1q86x_, d1q86y_, d1q86z_ |