SCOP 1.69: Domain d1q86c1: 1q86 C:91-237

Lineage for d1q86c1 (1q86 C:91-237)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.34: SH3-like barrel [50036] (15 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families)
   many known members contain KOW motif

5. Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)

6. Protein C-terminal domain of ribosomal protein L2 [50115] (2 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [50117] (19 PDB entries)

8. Domain d1q86c1: 1q86 C:91-237 [96166]
   Other proteins in same PDB: d1q861_, d1q862_, d1q863_, d1q864_, d1q86c2, d1q86d_, d1q86e_, d1q86f_, d1q86g1, d1q86g2, d1q86h_, d1q86i_, d1q86j_, d1q86k_, d1q86l_, d1q86m_, d1q86n_, d1q86o_, d1q86p_, d1q86q_, d1q86r_, d1q86s_, d1q86t_, d1q86u_, d1q86v_, d1q86w_, d1q86x_, d1q86y_, d1q86z_

Details for d1q86c1

PDB Entry: 1q86, 3 Å

PDB Description: crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.

SCOP Domain Sequences for d1q86c1:

Sequence; same for both SEQRES and ATOM records:

>d1q86c1 b.34.5.3 (C:91-237) C-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui}
gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp
qcratigvvggggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg
kpksisrnappgrkvgdiaskrtgrgg

Timeline for d1q86c1:

• d1q86c1 first appeared in SCOP 1.67
  
• d1q86c1 appears in SCOP 1.71
  
• d1q86c1 appears in the current release, SCOPe 2.08