Lineage for d1q863_ (1q86 3:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 544787Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (10 superfamilies)
    not a true fold
  4. 544788Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
    interrupted alpha-helix
  5. 544789Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 544790Protein Ribosomal protein L39e [48664] (1 species)
  7. 544791Species Archaeon Haloarcula marismortui [TaxId:2238] [48665] (19 PDB entries)
  8. 544810Domain d1q863_: 1q86 3: [96164]
    Other proteins in same PDB: d1q861_, d1q862_, d1q864_, d1q86c1, d1q86c2, d1q86d_, d1q86e_, d1q86f_, d1q86g1, d1q86g2, d1q86h_, d1q86i_, d1q86j_, d1q86k_, d1q86l_, d1q86m_, d1q86n_, d1q86o_, d1q86p_, d1q86q_, d1q86r_, d1q86s_, d1q86t_, d1q86u_, d1q86v_, d1q86w_, d1q86x_, d1q86y_, d1q86z_
    complexed with cd, cl, k, mg, na, pha

Details for d1q863_

PDB Entry: 1q86 (more details), 3 Å

PDB Description: crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.

SCOP Domain Sequences for d1q863_:

Sequence, based on SEQRES records: (download)

>d1q863_ a.137.1.1 (3:) Ribosomal protein L39e {Archaeon Haloarcula marismortui}
gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d1q863_ a.137.1.1 (3:) Ribosomal protein L39e {Archaeon Haloarcula marismortui}
gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde

SCOP Domain Coordinates for d1q863_:

Click to download the PDB-style file with coordinates for d1q863_.
(The format of our PDB-style files is described here.)

Timeline for d1q863_: