Lineage for d1q861_ (1q86 1:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 751110Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (6 families) (S)
  5. 751111Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
  6. 751112Protein Ribosomal protein L37ae [57831] (1 species)
  7. 751113Species Archaeon Haloarcula marismortui [TaxId:2238] [57832] (40 PDB entries)
  8. 751152Domain d1q861_: 1q86 1: [96162]
    Other proteins in same PDB: d1q862_, d1q863_, d1q864_, d1q86c1, d1q86c2, d1q86d_, d1q86e_, d1q86f_, d1q86g1, d1q86g2, d1q86h_, d1q86i_, d1q86j_, d1q86k_, d1q86l_, d1q86m_, d1q86n_, d1q86o_, d1q86p_, d1q86q_, d1q86r_, d1q86s_, d1q86t_, d1q86u_, d1q86v_, d1q86w_, d1q86x_, d1q86y_, d1q86z_
    complexed with cd, cl, k, mg, na, pha

Details for d1q861_

PDB Entry: 1q86 (more details), 3 Å

PDB Description: crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
PDB Compounds: (1:) L37Ae 50S ribosomal protein

SCOP Domain Sequences for d1q861_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q861_ g.41.8.1 (1:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]}
rtgrfgpryglkirvrvadveikhkkkhkcpvcgfkklkragtgiwmcghcgykiaggcy
qpetvagkavmka

SCOP Domain Coordinates for d1q861_:

Click to download the PDB-style file with coordinates for d1q861_.
(The format of our PDB-style files is described here.)

Timeline for d1q861_: