Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.29: Ribosomal protein L31e [54574] (1 superfamily) beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342 |
Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) automatically mapped to Pfam PF01198 |
Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein) |
Protein Ribosomal protein L31e [54577] (1 species) |
Species Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries) Uniprot P18138 |
Domain d1q82y_: 1q82 Y: [96152] Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82z_ protein/RNA complex; complexed with cd, cl, k, mg, na, ppu |
PDB Entry: 1q82 (more details), 2.98 Å
SCOPe Domain Sequences for d1q82y_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q82y_ d.29.1.1 (Y:) Ribosomal protein L31e {Haloarcula marismortui [TaxId: 2238]} ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant pskirvraarfeeegeaiveae
Timeline for d1q82y_:
View in 3D Domains from other chains: (mouse over for more information) d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82z_ |