![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) ![]() automatically mapped to Pfam PF00831 |
![]() | Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein) |
![]() | Protein Ribosomal protein L29 (L29p) [46563] (5 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [46564] (40 PDB entries) Uniprot P10971 |
![]() | Domain d1q82w_: 1q82 W: [96150] Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82x_, d1q82y_, d1q82z_ protein/RNA complex; complexed with cd, cl, k, mg, na, ppu |
PDB Entry: 1q82 (more details), 2.98 Å
SCOPe Domain Sequences for d1q82w_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q82w_ a.2.2.1 (W:) Ribosomal protein L29 (L29p) {Haloarcula marismortui [TaxId: 2238]} tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq geegd
Timeline for d1q82w_:
![]() Domains from other chains: (mouse over for more information) d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82x_, d1q82y_, d1q82z_ |