SCOP 1.69: Domain d1q82r_: 1q82 R:

Lineage for d1q82r_ (1q82 R:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.34: SH3-like barrel [50036] (15 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families)
   many known members contain KOW motif

5. Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)

6. Protein Ribosomal proteins L21e [50108] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [50109] (19 PDB entries)

8. Domain d1q82r_: 1q82 R: [96145]
   Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_

Details for d1q82r_

PDB Entry: 1q82, 2.98 Å

PDB Description: crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit

SCOP Domain Sequences for d1q82r_:

Sequence; same for both SEQRES and ATOM records:

>d1q82r_ b.34.5.1 (R:) Ribosomal proteins L21e {Archaeon Haloarcula marismortui}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe

Timeline for d1q82r_:

• d1q82r_ first appeared in SCOP 1.67
  
• d1q82r_ appears in SCOP 1.71
  
• d1q82r_ appears in the current release, SCOPe 2.08