![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily) beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243 |
![]() | Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) ![]() |
![]() | Family d.12.1.2: L15e [54193] (1 protein) elaborated with additional structures |
![]() | Protein Ribosomal protein L15e [54194] (1 species) |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [54195] (19 PDB entries) |
![]() | Domain d1q82n_: 1q82 N: [96141] Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_ complexed with cd, cl, k, mg, na, ppu |
PDB Entry: 1q82 (more details), 2.98 Å
SCOP Domain Sequences for d1q82n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q82n_ d.12.1.2 (N:) Ribosomal protein L15e {Archaeon Haloarcula marismortui} arsaysyireawkrpkegqiaelmwhrmqewrnepavvrierptrldrarslgykakqgi ivvrvairkgssrrtrfnkgrrskrmmvnritrkkniqriaeeranrkfpnlrvlnsysv gedgrhkwhevilidpdhpaiksddqlswisrtrhrlrtfrgltsagrrcrglrgqgkgs ekvrpslrvngaka
Timeline for d1q82n_:
![]() Domains from other chains: (mouse over for more information) d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_ |