Lineage for d1q82j_ (1q82 J:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410850Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 410941Superfamily d.41.4: Ribosomal protein L10e [54686] (1 family) (S)
  5. 410942Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein)
  6. 410943Protein Ribosomal protein L10e [54688] (1 species)
  7. 410944Species Archaeon Haloarcula marismortui [TaxId:2238] [54689] (18 PDB entries)
  8. 410951Domain d1q82j_: 1q82 J: [96137]
    Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_
    complexed with cd, cl, k, mg, na, ppu

Details for d1q82j_

PDB Entry: 1q82 (more details), 2.98 Å

PDB Description: crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit

SCOP Domain Sequences for d1q82j_:

Sequence, based on SEQRES records: (download)

>d1q82j_ d.41.4.1 (J:) Ribosomal protein L10e {Archaeon Haloarcula marismortui}
kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna
leaarvaanryvqnsgaaanykfrirkfpfhvirenkaaaaaaaaaaadgmrapfgkpvg
taarvhganhifiawvnpdpnveeawrrakmkvtptinidsspagna

Sequence, based on observed residues (ATOM records): (download)

>d1q82j_ d.41.4.1 (J:) Ribosomal protein L10e {Archaeon Haloarcula marismortui}
kpgamyrnsskpaytrreyisgipgkkiaqfdmgnngagptypaqvelvvekpvqirhna
leaarvaanryvqnsgaaanykfrirkfpfhvirenkdgmrapfgkpvgtaarvhganhi
fiawvnpdpnveeawrrakmkvtptinidsspagna

SCOP Domain Coordinates for d1q82j_:

Click to download the PDB-style file with coordinates for d1q82j_.
(The format of our PDB-style files is described here.)

Timeline for d1q82j_: