Lineage for d1q82g1 (1q82 G:1-79)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1041603Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 1041604Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 1041605Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 1041606Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 1041686Species Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries)
    Uniprot P14135
  8. 1041745Domain d1q82g1: 1q82 G:1-79 [96133]
    Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_
    protein/RNA complex; complexed with cd, cl, k, mg, na, ppu

Details for d1q82g1

PDB Entry: 1q82 (more details), 2.98 Å

PDB Description: crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
PDB Compounds: (G:) 50S ribosomal protein L6P

SCOPe Domain Sequences for d1q82g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q82g1 d.141.1.1 (G:1-79) Ribosomal protein L6 {Haloarcula marismortui [TaxId: 2238]}
prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
tigtfqshienmfhgvteg

SCOPe Domain Coordinates for d1q82g1:

Click to download the PDB-style file with coordinates for d1q82g1.
(The format of our PDB-style files is described here.)

Timeline for d1q82g1: