Lineage for d1q82c1 (1q82 C:91-237)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 557280Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 557707Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families) (S)
    many known members contain KOW motif
  5. 557773Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 557774Protein C-terminal domain of ribosomal protein L2 [50115] (2 species)
  7. 557775Species Archaeon Haloarcula marismortui [TaxId:2238] [50117] (19 PDB entries)
  8. 557783Domain d1q82c1: 1q82 C:91-237 [96128]
    Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q824_, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_
    complexed with cd, cl, k, mg, na, ppu

Details for d1q82c1

PDB Entry: 1q82 (more details), 2.98 Å

PDB Description: crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit

SCOP Domain Sequences for d1q82c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q82c1 b.34.5.3 (C:91-237) C-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui}
gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp
qcratigvvggggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg
kpksisrnappgrkvgdiaskrtgrgg

SCOP Domain Coordinates for d1q82c1:

Click to download the PDB-style file with coordinates for d1q82c1.
(The format of our PDB-style files is described here.)

Timeline for d1q82c1: