![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (16 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (6 families) ![]() |
![]() | Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein) |
![]() | Protein Ribosomal protein L44e [57837] (1 species) |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [57838] (40 PDB entries) |
![]() | Domain d1q824_: 1q82 4: [96127] Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_ complexed with cd, cl, k, mg, na, ppu |
PDB Entry: 1q82 (more details), 2.98 Å
SCOP Domain Sequences for d1q824_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q824_ g.41.8.3 (4:) Ribosomal protein L44e {Archaeon Haloarcula marismortui [TaxId: 2238]} mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk ptkktdlkyrcgecgkahlregwragrlefqe
Timeline for d1q824_:
![]() Domains from other chains: (mouse over for more information) d1q821_, d1q822_, d1q823_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_ |