Lineage for d1q821_ (1q82 1:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 624613Fold g.41: Rubredoxin-like [57769] (14 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 624941Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (4 families) (S)
  5. 624942Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
  6. 624943Protein Ribosomal protein L37ae [57831] (1 species)
  7. 624944Species Archaeon Haloarcula marismortui [TaxId:2238] [57832] (19 PDB entries)
  8. 624952Domain d1q821_: 1q82 1: [96124]
    Other proteins in same PDB: d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_
    complexed with cd, cl, k, mg, na, ppu

Details for d1q821_

PDB Entry: 1q82 (more details), 2.98 Å

PDB Description: crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit

SCOP Domain Sequences for d1q821_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q821_ g.41.8.1 (1:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui}
rtgrfgpryglkirvrvadveikhkkkhkcpvcgfkklkragtgiwmcghcgykiaggcy
qpetvagkavmka

SCOP Domain Coordinates for d1q821_:

Click to download the PDB-style file with coordinates for d1q821_.
(The format of our PDB-style files is described here.)

Timeline for d1q821_: