| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.9: Barstar-like [52037] (2 superfamilies) 2 layers, a/b; parallel beta-sheet of 3 strands, order 123 |
Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) ![]() |
| Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein) contains irregular N-terminal extension to the common fold |
| Protein Ribosomal protein L32e [52044] (1 species) |
| Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries) Uniprot P12736 |
| Domain d1q81z_: 1q81 Z: [96123] Other proteins in same PDB: d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_ protein/RNA complex; complexed with cd, cl, k, mg, na, ppu |
PDB Entry: 1q81 (more details), 2.95 Å
SCOPe Domain Sequences for d1q81z_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q81z_ c.9.2.1 (Z:) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev
Timeline for d1q81z_:
View in 3DDomains from other chains: (mouse over for more information) d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_ |