Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily) core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold |
Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) |
Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins) |
Protein Archaeal L30 (L30a) [55133] (1 species) long-chain member of the family; contains additional C-terminal (sub)domain |
Species Archaeon Haloarcula marismortui [TaxId:2238] [55134] (40 PDB entries) |
Domain d1q81x_: 1q81 X: [96121] Other proteins in same PDB: d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81y_, d1q81z_ complexed with cd, cl, k, mg, na, ppu |
PDB Entry: 1q81 (more details), 2.95 Å
SCOP Domain Sequences for d1q81x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q81x_ d.59.1.1 (X:) Archaeal L30 (L30a) {Archaeon Haloarcula marismortui [TaxId: 2238]} mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp prgghdgvkhpvkeggqlgkhdtegiddlleamr
Timeline for d1q81x_:
View in 3D Domains from other chains: (mouse over for more information) d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81y_, d1q81z_ |