Lineage for d1q81t_ (1q81 T:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598070Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 598071Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 598072Family d.12.1.1: L23p [54190] (1 protein)
  6. 598073Protein Ribosomal protein L23 [54191] (2 species)
  7. 598074Species Archaeon Haloarcula marismortui [TaxId:2238] [54192] (19 PDB entries)
  8. 598081Domain d1q81t_: 1q81 T: [96117]
    Other proteins in same PDB: d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_
    complexed with cd, cl, k, mg, na, ppu

Details for d1q81t_

PDB Entry: 1q81 (more details), 2.95 Å

PDB Description: crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.

SCOP Domain Sequences for d1q81t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q81t_ d.12.1.1 (T:) Ribosomal protein L23 {Archaeon Haloarcula marismortui}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

SCOP Domain Coordinates for d1q81t_:

Click to download the PDB-style file with coordinates for d1q81t_.
(The format of our PDB-style files is described here.)

Timeline for d1q81t_: