![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily) multihelical; consists of two different 3-helical domains connected by a long, partly helical linker |
![]() | Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) ![]() |
![]() | Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein) |
![]() | Protein Ribosomal protein L19 (L19e) [48142] (1 species) |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [48143] (40 PDB entries) |
![]() | Domain d1q81q_: 1q81 Q: [96114] Other proteins in same PDB: d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_ complexed with cd, cl, k, mg, na, ppu |
PDB Entry: 1q81 (more details), 2.95 Å
SCOP Domain Sequences for d1q81q_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q81q_ a.94.1.1 (Q:) Ribosomal protein L19 (L19e) {Archaeon Haloarcula marismortui [TaxId: 2238]} tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr dlydkagggefdsvadleryida
Timeline for d1q81q_:
![]() Domains from other chains: (mouse over for more information) d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_ |