Lineage for d1q81q_ (1q81 Q:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 645350Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 645351Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
  5. 645352Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 645353Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 645354Species Archaeon Haloarcula marismortui [TaxId:2238] [48143] (40 PDB entries)
  8. 645390Domain d1q81q_: 1q81 Q: [96114]
    Other proteins in same PDB: d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_
    complexed with cd, cl, k, mg, na, ppu

Details for d1q81q_

PDB Entry: 1q81 (more details), 2.95 Å

PDB Description: crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.
PDB Compounds: (Q:) 50S ribosomal protein L19e

SCOP Domain Sequences for d1q81q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q81q_ a.94.1.1 (Q:) Ribosomal protein L19 (L19e) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOP Domain Coordinates for d1q81q_:

Click to download the PDB-style file with coordinates for d1q81q_.
(The format of our PDB-style files is described here.)

Timeline for d1q81q_: