![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily) beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243 |
![]() | Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) ![]() |
![]() | Family d.12.1.2: L15e [54193] (1 protein) elaborated with additional structures |
![]() | Protein Ribosomal protein L15e [54194] (1 species) |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [54195] (40 PDB entries) |
![]() | Domain d1q81n_: 1q81 N: [96111] Other proteins in same PDB: d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_ complexed with cd, cl, k, mg, na, ppu |
PDB Entry: 1q81 (more details), 2.95 Å
SCOP Domain Sequences for d1q81n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q81n_ d.12.1.2 (N:) Ribosomal protein L15e {Archaeon Haloarcula marismortui [TaxId: 2238]} arsaysyireawkrpkegqiaelmwhrmqewrnepavvrierptrldrarslgykakqgi ivvrvairkgssrrtrfnkgrrskrmmvnritrkkniqriaeeranrkfpnlrvlnsysv gedgrhkwhevilidpdhpaiksddqlswisrtrhrlrtfrgltsagrrcrglrgqgkgs ekvrpslrvngaka
Timeline for d1q81n_:
![]() Domains from other chains: (mouse over for more information) d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_ |