Lineage for d1q81i_ (1q81 I:)

  1. Root: SCOP 1.73
  2. 756025Class j: Peptides [58231] (120 folds)
  3. 757385Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 757386Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 757387Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 757388Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 757389Species Archaeon Haloarcula marismortui [TaxId:2238] [64662] (18 PDB entries)
  8. 757403Domain d1q81i_: 1q81 I: [96106]
    Other proteins in same PDB: d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_
    complexed with cd, cl, k, mg, na, ppu

Details for d1q81i_

PDB Entry: 1q81 (more details), 2.95 Å

PDB Description: crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.
PDB Compounds: (I:) Acidic ribosomal protein P0 homolog

SCOP Domain Sequences for d1q81i_:

Sequence, based on SEQRES records: (download)

>d1q81i_ j.84.1.1 (I:) Ribosomal protein L10 {Archaeon Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d1q81i_ j.84.1.1 (I:) Ribosomal protein L10 {Archaeon Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

SCOP Domain Coordinates for d1q81i_:

Click to download the PDB-style file with coordinates for d1q81i_.
(The format of our PDB-style files is described here.)

Timeline for d1q81i_: