Lineage for d1q81f_ (1q81 F:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 606001Fold d.77: Ribosomal protein L5 [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 606002Superfamily d.77.1: Ribosomal protein L5 [55282] (1 family) (S)
  5. 606003Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)
  6. 606004Protein Ribosomal protein L5 [55284] (3 species)
    synonym: 50S ribosomal protein L5p, HMAL5, HL13
  7. 606005Species Archaeon Haloarcula marismortui [TaxId:2238] [55285] (19 PDB entries)
  8. 606012Domain d1q81f_: 1q81 F: [96102]
    Other proteins in same PDB: d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_
    complexed with cd, cl, k, mg, na, ppu

Details for d1q81f_

PDB Entry: 1q81 (more details), 2.95 Å

PDB Description: crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.

SCOP Domain Sequences for d1q81f_:

Sequence, based on SEQRES records: (download)

>d1q81f_ d.77.1.1 (F:) Ribosomal protein L5 {Archaeon Haloarcula marismortui}
fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev

Sequence, based on observed residues (ATOM records): (download)

>d1q81f_ d.77.1.1 (F:) Ribosomal protein L5 {Archaeon Haloarcula marismortui}
fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
hrlnpadavafiestydvev

SCOP Domain Coordinates for d1q81f_:

Click to download the PDB-style file with coordinates for d1q81f_.
(The format of our PDB-style files is described here.)

Timeline for d1q81f_: