| Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
| Fold c.22: Ribosomal protein L4 [52165] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) ![]() |
| Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein) |
| Protein Ribosomal protein L4 [52168] (2 species) synonym: 50S ribosomal protein L4e, HMAL4, HL6 |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [52170] (18 PDB entries) |
| Domain d1q81e_: 1q81 E: [96101] Other proteins in same PDB: d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_ complexed with cd, cl, k, mg, na, ppu |
PDB Entry: 1q81 (more details), 2.95 Å
SCOP Domain Sequences for d1q81e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q81e_ c.22.1.1 (E:) Ribosomal protein L4 {Archaeon Haloarcula marismortui}
mqatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
aevaer
Timeline for d1q81e_:
View in 3DDomains from other chains: (mouse over for more information) d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_ |