Lineage for d1q812_ (1q81 2:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 624613Fold g.41: Rubredoxin-like [57769] (14 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 624941Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (4 families) (S)
  5. 624964Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein)
  6. 624965Protein Ribosomal protein L37e [57834] (1 species)
  7. 624966Species Archaeon Haloarcula marismortui [TaxId:2238] [57835] (19 PDB entries)
  8. 624973Domain d1q812_: 1q81 2: [96095]
    Other proteins in same PDB: d1q811_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_
    complexed with cd, cl, k, mg, na, ppu

Details for d1q812_

PDB Entry: 1q81 (more details), 2.95 Å

PDB Description: crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.

SCOP Domain Sequences for d1q812_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q812_ g.41.8.2 (2:) Ribosomal protein L37e {Archaeon Haloarcula marismortui}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

SCOP Domain Coordinates for d1q812_:

Click to download the PDB-style file with coordinates for d1q812_.
(The format of our PDB-style files is described here.)

Timeline for d1q812_: