| Class g: Small proteins [56992] (79 folds) |
| Fold g.41: Rubredoxin-like [57769] (14 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (4 families) ![]() |
| Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein) |
| Protein Ribosomal protein L37ae [57831] (1 species) |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [57832] (19 PDB entries) |
| Domain d1q811_: 1q81 1: [96094] Other proteins in same PDB: d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_ complexed with cd, cl, k, mg, na, ppu |
PDB Entry: 1q81 (more details), 2.95 Å
SCOP Domain Sequences for d1q811_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q811_ g.41.8.1 (1:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui}
rtgrfgpryglkirvrvadveikhkkkhkcpvcgfkklkragtgiwmcghcgykiaggcy
qpetvagkavmka
Timeline for d1q811_:
View in 3DDomains from other chains: (mouse over for more information) d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_ |