Lineage for d1q7yz_ (1q7y Z:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 577539Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 577568Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 577569Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 577570Protein Ribosomal protein L32e [52044] (1 species)
  7. 577571Species Archaeon Haloarcula marismortui [TaxId:2238] [52045] (19 PDB entries)
  8. 577585Domain d1q7yz_: 1q7y Z: [96089]
    Other proteins in same PDB: d1q7y1_, d1q7y2_, d1q7y3_, d1q7y4_, d1q7yc1, d1q7yc2, d1q7yd_, d1q7ye_, d1q7yf_, d1q7yg1, d1q7yg2, d1q7yh_, d1q7yi_, d1q7yj_, d1q7yk_, d1q7yl_, d1q7ym_, d1q7yn_, d1q7yo_, d1q7yp_, d1q7yq_, d1q7yr_, d1q7ys_, d1q7yt_, d1q7yu_, d1q7yv_, d1q7yw_, d1q7yx_, d1q7yy_
    complexed with cd, cl, k, mg, na, po4, puy

Details for d1q7yz_

PDB Entry: 1q7y (more details), 3.2 Å

PDB Description: crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit

SCOP Domain Sequences for d1q7yz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q7yz_ c.9.2.1 (Z:) Ribosomal protein L32e {Archaeon Haloarcula marismortui}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOP Domain Coordinates for d1q7yz_:

Click to download the PDB-style file with coordinates for d1q7yz_.
(The format of our PDB-style files is described here.)

Timeline for d1q7yz_: