Lineage for d1q7yw_ (1q7y W:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 633305Fold a.2: Long alpha-hairpin [46556] (19 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 633322Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
  5. 633323Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 633324Protein Ribosomal protein L29 (L29p) [46563] (4 species)
  7. 633325Species Archaeon Haloarcula marismortui [TaxId:2238] [46564] (44 PDB entries)
  8. 633365Domain d1q7yw_: 1q7y W: [96086]
    Other proteins in same PDB: d1q7y1_, d1q7y2_, d1q7y3_, d1q7y4_, d1q7yc1, d1q7yc2, d1q7yd_, d1q7ye_, d1q7yf_, d1q7yg1, d1q7yg2, d1q7yh_, d1q7yi_, d1q7yj_, d1q7yk_, d1q7yl_, d1q7ym_, d1q7yn_, d1q7yo_, d1q7yp_, d1q7yq_, d1q7yr_, d1q7ys_, d1q7yt_, d1q7yu_, d1q7yv_, d1q7yx_, d1q7yy_, d1q7yz_
    complexed with cd, cl, k, mg, na, po4, puy

Details for d1q7yw_

PDB Entry: 1q7y (more details), 3.2 Å

PDB Description: crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
PDB Compounds: (W:) 50S ribosomal protein L29P

SCOP Domain Sequences for d1q7yw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q7yw_ a.2.2.1 (W:) Ribosomal protein L29 (L29p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

SCOP Domain Coordinates for d1q7yw_:

Click to download the PDB-style file with coordinates for d1q7yw_.
(The format of our PDB-style files is described here.)

Timeline for d1q7yw_: