Lineage for d1q7ys_ (1q7y S:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503706Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 503707Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 503708Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 503709Protein Ribosomal protein L22 [54845] (2 species)
  7. 503710Species Archaeon Haloarcula marismortui [TaxId:2238] [54847] (19 PDB entries)
  8. 503724Domain d1q7ys_: 1q7y S: [96082]
    Other proteins in same PDB: d1q7y1_, d1q7y2_, d1q7y3_, d1q7y4_, d1q7yc1, d1q7yc2, d1q7yd_, d1q7ye_, d1q7yf_, d1q7yg1, d1q7yg2, d1q7yh_, d1q7yi_, d1q7yj_, d1q7yk_, d1q7yl_, d1q7ym_, d1q7yn_, d1q7yo_, d1q7yp_, d1q7yq_, d1q7yr_, d1q7yt_, d1q7yu_, d1q7yv_, d1q7yw_, d1q7yx_, d1q7yy_, d1q7yz_

Details for d1q7ys_

PDB Entry: 1q7y (more details), 3.2 Å

PDB Description: crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit

SCOP Domain Sequences for d1q7ys_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q7ys_ d.55.1.1 (S:) Ribosomal protein L22 {Archaeon Haloarcula marismortui}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

SCOP Domain Coordinates for d1q7ys_:

Click to download the PDB-style file with coordinates for d1q7ys_.
(The format of our PDB-style files is described here.)

Timeline for d1q7ys_: